Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAMTOR2 (Human) Recombinant Protein

  • Catalog # : P3418
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LAMTOR2 (NP_054736, 1 a.a. - 125 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSHMLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3418
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.2M NaCl, pH 8.0 (2 mM dithiothreitol, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • ROBLD3
  • Gene Alias:
  • ENDAP,HSPC003,MAPBPIP,MAPKSP1AP,p14
  • Gene Description:
  • roadblock domain containing 3
  • Gene Summary:
  • The product of this gene is highly conserved with a mouse protein associated with the cytoplasmic face of late endosomes and lysosomes. The mouse protein interacts with MAPK scaffold protein 1, a component of the mitogen-activated protein kinase pathway. In humans, a mutation in this gene has been associated with a primary immunodeficiency syndrome, and suggests a role for this protein in endosomal biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • MAPKSP1 adaptor protein,OTTHUMP00000018850,endosomal adaptor protein,mitogen activated protein binding protein interacting protein,mitogen-activated protein-binding protein-interacting protein,mitogen-activated protein-binding protein-interacting protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook