Product Browser

Last updated: 2017/8/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Vote for Cancer Research Topics & Genes to Win One Free Antibody
pathway

GOPC (Human) Recombinant Protein

  • Catalog # : P3403
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GOPC (NP_001017408, 278 a.a. - 454 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 21.5
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3403
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • GOPC
  • Gene Alias:
  • CAL,FIG,GOPC1,PIST,dJ94G16.2
  • Gene Description:
  • golgi associated PDZ and coiled-coil motif containing
  • Gene Summary:
  • PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM
  • Other Designations:
  • CFTR-associated ligand,Golgi associated PDZ and coiled-coil motif containing protein,OTTHUMP00000017088,OTTHUMP00000040403,PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10,dJ94G16.2 PIST,fused in glioblastoma
  • RSS
  • YouTube
  • Linkedin
  • Facebook