Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Scientific Image Contest
pathway

BMP4 (Human) Recombinant Protein

  • Catalog # : P3398
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BMP4 (NP_001193, 293 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 13.2
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Endotoxin Level:
  • < 1.0 EU per 1 microgram of protein (determined by LAL method)
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P3398
  • Storage Buffer:
  • In 10 mM Sodium citrate buffer, pH 3.5 (10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 652
  • Gene Name:
  • BMP4
  • Gene Alias:
  • BMP2B,BMP2B1,MCOPS6,ZYME
  • Gene Description:
  • bone morphogenetic protein 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein. [provided by RefSeq
  • Other Designations:
  • bone morphogenetic protein 2B
  • RSS
  • YouTube
  • Linkedin
  • Facebook