Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TGFB2 (Human) Recombinant Protein, ActiveBioActive

  • Catalog # : P3378
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TGFB2 (two 118 amino acids) recombinent protein with His tag expressed in Nicotiana benthamiana.
  • Sequence:
  • HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
  • Host:
  • Plants
  • Theoretical MW (kDa):
  • 27.08, 13.5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Non-transgenic plants (Nicotiana benthamiana) expression system
  • Purification:
  • Sequential chromatography (FPLC)
  • Purity:
  • > 97% by SDS-PAGE
  • Endotoxin Level:
  • < 0.04 EU/ug protein
  • Activity:
  • The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50≤ 50 ng/mL.
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P3378
    It has a predicted molecular mass of 27.08 kDa (13.5 kDa under reducing conditions in SDS-PAGE).
  • Storage Buffer:
  • Lyophilized from 0.05 M Tris-HCl, pH 7.4.
  • Storage Instruction:
  • Store at -20°C.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Datasheet:
  • Please see datasheet for the details.   PDF DownloadDownload
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western Blot analysis of 0.2 ug/lane recombinant TGFB2 protein.
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7042
  • Gene Name:
  • TGFB2
  • Gene Alias:
  • MGC116892,TGF-beta2
  • Gene Description:
  • transforming growth factor, beta 2
  • Other Designations:
  • OTTHUMP00000037528
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook