Product Browser

Last updated: 2017/1/15
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ANO1 monoclonal antibody, clone DOG1.1

  • Catalog # : MAB7926
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antobody raised against synthetic peptide of ANO1.
  • Immunogen:
  • A synthetic peptide corresponding to human ANO1.
  • Sequence:
  • MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER
  • Host:
  • Mouse
  • Reactivity:
  • Chicken, Hamster, Human, Rat
  • Form:
  • Liquid
  • Concentration:
  • 50 ug/mL
  • Recommend Usage:
  • Immunohistochemistry (1-2 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.3 (0.09% sodium azide)
  • Storage Instruction:
  • Store at 4°C.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunochemical staining of paraffin human gastrointestinal stroma tumor section stained with ANO1 monoclonal antibody, clone DOG1.1 (Cat # MAB7926), anti-mouse-HRPO polymer kit, and DAB. Please note that both membrane and cytoplasm may be stained.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • ANO1
  • Gene Alias:
  • FLJ10261,ORAOV2,TAOS2,TMEM16A
  • Gene Description:
  • anoctamin 1, calcium activated chloride channel
  • Other Designations:
  • membrane protein,oral cancer overexpressed 2,transmembrane protein 16A,transmembrane protein 16A (eight membrane-spanning domains),tumor amplified and overexpressed sequence 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook