Product Browser

Last updated: 2020/8/2

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TOMM20 monoclonal antibody, clone ARC5002 

  • Catalog # : MAB22612
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit monoclonal antibody raised against partial recombinant human TOMM20.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 20-145 of human TOMM20.
  • Sequence:
  • YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Affinity purification
  • Isotype:
  • IgG
  • Recommend Usage:
  • Immunofluorescence (1:50-1:1000)
    Immunohistochemistry (1:50-1:1000)
    Immunoprecipitation (1:20-1:50)
    Western Blot (1:1000-1:50000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.3 (50% glycerol, 0.09% sodium azide).
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot
  • Western Blot
  • Western Blot analysis of (1) THP-1, (2) HeLa, (3) MCF-7 cell lysates, (4) mouse brain.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry staining of rat kidney.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry staining of mouse heart.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry staining of human colon cancer.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence staining of HeLa cells. Blue: DAPI for nuclear staining.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence staining of C6 cells. Blue: DAPI for nuclear staining.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescence staining of NIH/3T3 cells. Blue: DAPI for nuclear staining.
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation analysis of HeLa cell lysates. Lane 1 : Input. Lane 2 : IP with control rabbit IgG. Lane 3 : IP with TOMM20 monoclonal antibody, clone ARC5002.
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9804
  • Gene Name:
  • TOMM20
  • Gene Alias:
  • KIAA0016,MAS20,MGC117367,MOM19,TOM20
  • Gene Description:
  • translocase of outer mitochondrial membrane 20 homolog (yeast)
  • Other Designations:
  • OTTHUMP00000037593,translocase of outer mitochondrial membrane 20 homolog,translocase of outer mitochondrial membrane 20 homolog type II
  • RSS
  • YouTube
  • Linkedin
  • Facebook