Product Browser

Last updated: 2019/9/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Abcc8/Abcc9 monoclonal antibody, clone S323A-31 (P594) 

  • Catalog # : MAB18479
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant rat Abcc8/Abcc9.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 1503-1545 at C-terminus of rat Abcc9.
  • Sequence:
  • [protein fragment, 43 aa]
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Form:
  • Liquid
  • Conjugation:
  • P594
  • Purification:
  • Protein G purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Immunocytochemistry (1:100)
    Immunofluorescence (1:100)
    Western Blot (1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.4 (50% glycerol, 0.09% sodium azide).
  • Storage Instruction:
  • Store at -20°C.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of rat brain membrane lysate with Abcc8/Abcc9 monoclonal antibody, clone S323A-31 (P594) (Cat # MAB18479).
  • Immunocytochemistry
  • Immunocytochemistry
  • Immunocytochemical staining of SK-N-BE with Abcc8/Abcc9 monoclonal antibody, clone S323A-31 (P594) (Cat # MAB18479). (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) Abcc8/Abcc9 Antibody and (D) Composite.
  • Immunofluorescence
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunofluorescence
  • Gene Information
  • Protein Accession#:
  • Q09429;Q63563
  • Gene Name:
  • Abcc8
  • Gene Alias:
  • Sur,Sur1
  • Gene Description:
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 8
  • Other Designations:
  • ATP-binding cassette subfamily C (CFTR/MRP) member 8,ATP-binding cassette, subfamily C (CFTR/MRP), member 8,Sulfonylurea receptor
  • Gene Information
  • Protein Accession#:
  • Q09429;Q63563
  • Gene Name:
  • Abcc9
  • Gene Alias:
  • Sur2
  • Gene Description:
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 9
  • Other Designations:
  • Sulfonylurea receptor 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook