Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MCU monoclonal antibody, clone CL3576

  • Catalog # : MAB15807
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human MCU.
  • Immunogen:
  • Recombinant protein corresponding to human MCU.
  • Sequence:
  • TRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence RDRQYLLFFH as determined by overlapping synthetic peptides.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of A-549 cell lysate with MCU monoclonal antibody, clone CL3576 (Cat # MAB15807).
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of A549 cells with MCU monoclonal antibody, clone CL3576 (Cat # MAB15807) (Green) shows specific in the mitochondria. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MCU
  • Gene Alias:
  • C10orf42,CCDC109A
  • Gene Description:
  • mitochondrial calcium uniporter
  • Other Designations:
  • calcium uniporter protein, mitochondrial; coiled-coil domain-containing protein 109A
  • RSS
  • YouTube
  • Linkedin
  • Facebook