Product Browser

Last updated: 2018/1/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAMA2 monoclonal antibody, clone CL3450

  • Catalog # : MAB15802
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human LAMA2.
  • Immunogen:
  • Recombinant protein corresponding to human LAMA2.
  • Sequence:
  • DKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGT
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence DKLKPIKELEDNLKK as determined by overlapping synthetic peptides.
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western Blot analysis of recombinant protein Lane 1: Laminin-211, Lane 2: Laminin-221, Lane 3: Laminin-332, Lane 4: Laminin-421, Lane 5: Laminin-511 and Lane 6: Laminin-121 with LAMA2 monoclonal antibody, clone CL3450 (Cat # MAB15802).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart muscle with LAMA2 monoclonal antibody, clone CL3450 (Cat # MAB15802) shows membranous immunoreactivity in muscle fibers.
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3908
  • Gene Name:
  • LAMA2
  • Gene Alias:
  • LAMM
  • Gene Description:
  • laminin, alpha 2
  • Gene Summary:
  • Laminin, an extracellular protein, is a major component of the basement membrane. It is thought to mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. It is composed of three subunits, alpha, beta, and gamma, which are bound to each other by disulfide bonds into a cross-shaped molecule. This gene encodes the alpha 2 chain, which constitutes one of the subunits of laminin 2 (merosin) and laminin 4 (s-merosin). Mutations in this gene have been identified as the cause of congenital merosin-deficient muscular dystrophy. Two transcript variants encoding different proteins have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017189,laminin M,laminin alpha 2 subunit,merosin heavy chain
  • RSS
  • YouTube
  • Linkedin
  • Facebook