Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAMB3 monoclonal antibody, clone CL3353

  • Catalog # : MAB15799
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human LAMB3.
  • Immunogen:
  • Recombinant protein corresponding to human LAMB3.
  • Sequence:
  • KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence ASEQALSAQEGFERI as determined by overlapping synthetic peptides.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human lung tissue lysate with LAMB3 monoclonal antibody, clone CL3353 (Cat # MAB15799).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate with LAMB3 monoclonal antibody, clone CL3353 (Cat # MAB15799) shows immunoreactivity in basement membrane of glandular epithelium.
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3914
  • Gene Name:
  • LAMB3
  • Gene Alias:
  • BM600-125KDA,FLJ99565,LAM5,LAMNB1
  • Gene Description:
  • laminin, beta 3
  • Gene Summary:
  • The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000034555,OTTHUMP00000034640,kalinin B1 chain,kalinin-140kDa,laminin B1k chain,laminin S B3 chain,laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD)),nicein-125kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook