LAMA3 monoclonal antibody, clone CL3112
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Recombinant protein)
Western Blot analysis of recombinant protein Lane 1: Laminin-332, Lane 2: Laminin-421, Lane 3: Laminin-511, Lane 4: Laminin-121 and Lane 5: Laminin-221 with LAMA3 monoclonal antibody, clone CL3112 (Cat # MAB15789).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with LAMA3 monoclonal antibody, clone CL3112 (Cat # MAB15789) shows moderate immunoreactivity in basement membrane of glandular epithelium.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human LAMA3.
Immunogen
Recombinant protein corresponding to human LAMA3.
Epitope
This antibody binds to an epitope located within the peptide sequence EINSLQSDFT as determined by overlapping synthetic peptides.
Sequence
LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Recombinant protein)
Western Blot analysis of recombinant protein Lane 1: Laminin-332, Lane 2: Laminin-421, Lane 3: Laminin-511, Lane 4: Laminin-121 and Lane 5: Laminin-221 with LAMA3 monoclonal antibody, clone CL3112 (Cat # MAB15789).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with LAMA3 monoclonal antibody, clone CL3112 (Cat # MAB15789) shows moderate immunoreactivity in basement membrane of glandular epithelium. -
Gene Info — LAMA3
Entrez GeneID
3909Protein Accession#
Q16787Gene Name
LAMA3
Gene Alias
BM600, E170, LAMNA, LOCS, lama3a
Gene Description
laminin, alpha 3
Gene Ontology
HyperlinkGene Summary
Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
BM600 150kD subunit|epiligrin 170 kda subunit|epiligrin alpha 3 subunit|kalinin 165kD subunit|laminin alpha 3 subunit|laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin)|laminin-5 alpha 3 chain|nicein 150kD subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com