Product Browser

Last updated: 2018/1/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAMA3 monoclonal antibody, clone CL3112

  • Catalog # : MAB15789
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human LAMA3.
  • Immunogen:
  • Recombinant protein corresponding to human LAMA3.
  • Sequence:
  • LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence EINSLQSDFT as determined by overlapping synthetic peptides.
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western Blot analysis of recombinant protein Lane 1: Laminin-332, Lane 2: Laminin-421, Lane 3: Laminin-511, Lane 4: Laminin-121 and Lane 5: Laminin-221 with LAMA3 monoclonal antibody, clone CL3112 (Cat # MAB15789).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with LAMA3 monoclonal antibody, clone CL3112 (Cat # MAB15789) shows moderate immunoreactivity in basement membrane of glandular epithelium.
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3909
  • Gene Name:
  • LAMA3
  • Gene Alias:
  • BM600,E170,LAMNA,LOCS,lama3a
  • Gene Description:
  • laminin, alpha 3
  • Gene Summary:
  • Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • BM600 150kD subunit,epiligrin 170 kda subunit,epiligrin alpha 3 subunit,kalinin 165kD subunit,laminin alpha 3 subunit,laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin),laminin-5 alpha 3 chain,nicein 150kD subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook