LAMC2 monoclonal antibody, clone CL2980

Catalog # MAB15783

Size

Price

Stock

Quantity

Size:100 uL
Price: USD $ 428.00
Stock:
order now, ship in 5 days
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

Western Blot analysis of A-431 cell lysate with LAMC2 monoclonal antibody, clone CL2980 (Cat # MAB15783).

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with LAMC2 monoclonal antibody, clone CL2980 (Cat # MAB15783) shows strong immunoreactivity in basement membrane of squamous epithelium.

  • Specification

    Product Description

    Mouse monoclonal antibody raised against partial recombinant human LAMC2.

    Immunogen

    Recombinant protein corresponding to human LAMC2.

    Epitope

    This antibody binds to an epitope located within the peptide sequence IQDTLNTLDGLLHLM as determined by overlapping synthetic peptides.

    Sequence

    NAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRPMMSELEERARQQRGHLHLLETSIDGILADVKNLEN

    Host

    Mouse

    Reactivity

    Human

    Form

    Liquid

    Purification

    Protein A purification

    Isotype

    IgG1

    Recommend Usage

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.

    Storage Buffer

    In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).

    Storage Instruction

    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.

    Note

    This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

  • Applications

    Western Blot (Cell lysate)

    Western Blot analysis of A-431 cell lysate with LAMC2 monoclonal antibody, clone CL2980 (Cat # MAB15783).

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with LAMC2 monoclonal antibody, clone CL2980 (Cat # MAB15783) shows strong immunoreactivity in basement membrane of squamous epithelium.
  • Gene Info — LAMC2

    Entrez GeneID

    3918

    Protein Accession#

    Q13753

    Gene Name

    LAMC2

    Gene Alias

    B2T, BM600, CSF, EBR2, EBR2A, LAMB2T, LAMNB2, MGC138491, MGC141938

    Gene Description

    laminin, gamma 2

    Omim ID

    150292 226650 226700

    Gene Ontology

    Hyperlink

    Gene Summary

    Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 2. The gamma 2 chain, formerly thought to be a truncated version of beta chain (B2t), is highly homologous to the gamma 1 chain; however, it lacks domain VI, and domains V, IV and III are shorter. It is expressed in several fetal tissues but differently from gamma 1, and is specifically localized to epithelial cells in skin, lung and kidney. The gamma 2 chain together with alpha 3 and beta 3 chains constitute laminin 5 (earlier known as kalinin), which is an integral part of the anchoring filaments that connect epithelial cells to the underlying basement membrane. The epithelium-specific expression of the gamma 2 chain implied its role as an epithelium attachment molecule, and mutations in this gene have been associated with junctional epidermolysis bullosa, a skin disease characterized by blisters due to disruption of the epidermal-dermal junction. Two transcript variants resulting from alternative splicing of the 3' terminal exon, and encoding different isoforms of gamma 2 chain, have been described. The two variants are differentially expressed in embryonic tissues, however, the biological significance of the two forms is not known. Transcript variants utilizing alternative polyA_signal have also been noted in literature. [provided by RefSeq

    Other Designations

    BM600-100kDa|OTTHUMP00000033550|cell-scattering factor (140kDa)|epiligrin|kalinin (105kD)|kalinin-105kDa|ladsin (140kDa)|laminin, gamma 2 (nicein (100kD), kalinin (105kD), BM600 (100kD), Herlitz junctional epidermolysis bullosa))|nicein (100kDa)|nicein-10

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All