LAMB2 monoclonal antibody, clone CL2976

Catalog # MAB15782

Size

Price

Stock

Quantity

Size:100 uL
Price: USD $ 428.00
Stock:
order now, ship in 5 days
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

Western Blot analysis of human lung tissue lysate with LAMB2 monoclonal antibody, clone CL2976 (Cat # MAB15782).

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart with LAMB2 monoclonal antibody, clone CL2976 (Cat # MAB15782) shows strong membranous immunoreactivity in cardiomyocytes.

  • Specification

    Product Description

    Mouse monoclonal antibody raised against partial recombinant human LAMB2.

    Immunogen

    Recombinant protein corresponding to human LAMB2.

    Epitope

    This antibody binds to an epitope located within the peptide sequence NANHALSGLERDRLA as determined by overlapping synthetic peptides.

    Sequence

    DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG

    Host

    Mouse

    Reactivity

    Human

    Form

    Liquid

    Purification

    Protein A purification

    Isotype

    IgG1

    Recommend Usage

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.

    Storage Buffer

    In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).

    Storage Instruction

    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.

    Note

    This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

  • Applications

    Western Blot (Tissue lysate)

    Western Blot analysis of human lung tissue lysate with LAMB2 monoclonal antibody, clone CL2976 (Cat # MAB15782).

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human heart with LAMB2 monoclonal antibody, clone CL2976 (Cat # MAB15782) shows strong membranous immunoreactivity in cardiomyocytes.
  • Gene Info — LAMB2

    Entrez GeneID

    3913

    Protein Accession#

    P55268

    Gene Name

    LAMB2

    Gene Alias

    LAMS

    Gene Description

    laminin, beta 2 (laminin S)

    Omim ID

    150325 609049

    Gene Ontology

    Hyperlink

    Gene Summary

    Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the beta chain isoform laminin, beta 2. The beta 2 chain contains the 7 structural domains typical of beta chains of laminin, including the short alpha region. However, unlike beta 1 chain, beta 2 has a more restricted tissue distribution. It is enriched in the basement membrane of muscles at the neuromuscular junctions, kidney glomerulus and vascular smooth muscle. Transgenic mice in which the beta 2 chain gene was inactivated by homologous recombination, showed defects in the maturation of neuromuscular junctions and impairment of glomerular filtration. Alternative splicing involving a non consensus 5' splice site (gc) in the 5' UTR of this gene has been reported. It was suggested that inefficient splicing of this first intron, which does not change the protein sequence, results in a greater abundance of the unspliced form of the transcript than the spliced form. The full-length nature of the spliced transcript is not known. [provided by RefSeq

    Other Designations

    laminin S|laminin, beta 2

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All