GAD1 monoclonal antibody, clone CL2911
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue lysate with GAD1 monoclonal antibody, clone CL2911 (Cat # MAB15778).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with GAD1 monoclonal antibody, clone CL2911 (Cat # MAB15778) shows immunoreactivity in neuropil, as well as some neuronal cells bodies.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human GAD1.
Immunogen
Recombinant protein corresponding to human GAD1.
Epitope
This antibody binds to an epitope located within the peptide sequence TETDFSNLFA as determined by overlapping synthetic peptides.
Sequence
QSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRS
Host
Mouse
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Protein A purification
Isotype
IgG2a
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue lysate with GAD1 monoclonal antibody, clone CL2911 (Cat # MAB15778).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with GAD1 monoclonal antibody, clone CL2911 (Cat # MAB15778) shows immunoreactivity in neuropil, as well as some neuronal cells bodies. -
Gene Info — GAD1
Entrez GeneID
2571Protein Accession#
Q99259Gene Name
GAD1
Gene Alias
FLJ45882, GAD, SCP
Gene Description
glutamate decarboxylase 1 (brain, 67kDa)
Gene Ontology
HyperlinkGene Summary
This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form. [provided by RefSeq
Other Designations
OTTHUMP00000041055|glutamate decarboxylase 1|glutamate decarboxylase 1 (brain, 67kD)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com