MBP monoclonal antibody, clone CL2819
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue lysate with MBP monoclonal antibody, clone CL2819 (Cat # MAB15775).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MBP monoclonal antibody, clone CL2819 (Cat # MAB15775) shows strong immunoreactivity in myelinated fibers.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human MBP.
Immunogen
Recombinant protein corresponding to human MBP.
Epitope
This antibody binds to an epitope located within the peptide sequence RTPPPSQGKG as determined by overlapping synthetic peptides.
Sequence
DENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPM
Host
Mouse
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Protein A purification
Isotype
IgG2a
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue lysate with MBP monoclonal antibody, clone CL2819 (Cat # MAB15775).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with MBP monoclonal antibody, clone CL2819 (Cat # MAB15775) shows strong immunoreactivity in myelinated fibers. -
Gene Info — MBP
Entrez GeneID
4155Protein Accession#
P02686Gene Name
MBP
Gene Alias
MGC99675
Gene Description
myelin basic protein
Omim ID
159430Gene Ontology
HyperlinkGene Summary
The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called "Golli-MBP") that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes. [provided by RefSeq
Other Designations
Golli-mbp|OTTHUMP00000174383|OTTHUMP00000174384|OTTHUMP00000174385|OTTHUMP00000174386
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com