S100B monoclonal antibody, clone CL2720
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human S100B.
Immunogen
Recombinant protein corresponding to human S100B.
Sequence
LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Host
Mouse
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue lysate with S100B monoclonal antibody, clone CL2720 (Cat # MAB15770).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with S100B monoclonal antibody, clone CL2720 (Cat # MAB15770) shows moderate immunoreactivity in a subset of astrocytes. -
Gene Info — S100B
Entrez GeneID
6285Protein Accession#
P04271Gene Name
S100B
Gene Alias
NEF, S100, S100beta
Gene Description
S100 calcium binding protein B
Omim ID
176990Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. [provided by RefSeq
Other Designations
OTTHUMP00000174958|S-100 calcium-binding protein, beta chain|S100 beta|S100 calcium binding protein, beta (neural)|S100 calcium-binding protein, beta|S100 calcium-binding protein, beta (neural)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com