CS monoclonal antibody, clone CL2579
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of U-251 MG cell lysate with CS monoclonal antibody, clone CL2579 (Cat # MAB15758).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with CS monoclonal antibody, clone CL2579 (Cat # MAB15758) shows granular cytoplasmic immunoreactivity in hepatocytes.
Immunofluorescence
Immunofluorescent staining of MCF7 cells with CS monoclonal antibody, clone CL2579 (Cat # MAB15758) (Green) shows specific mitochondrial. Microtubule and nuclear probes are visualized in red and blue respectively (where available).
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human CS.
Immunogen
Recombinant protein corresponding to human CS.
Epitope
This antibody binds to an epitope located within the peptide sequence AKGGEEPLPEGLFWL as determined by overlapping synthetic peptides.
Sequence
ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of U-251 MG cell lysate with CS monoclonal antibody, clone CL2579 (Cat # MAB15758).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with CS monoclonal antibody, clone CL2579 (Cat # MAB15758) shows granular cytoplasmic immunoreactivity in hepatocytes.Immunofluorescence
Immunofluorescent staining of MCF7 cells with CS monoclonal antibody, clone CL2579 (Cat # MAB15758) (Green) shows specific mitochondrial. Microtubule and nuclear probes are visualized in red and blue respectively (where available). -
Gene Info — CS
Entrez GeneID
1431Protein Accession#
O75390Gene Name
CS
Gene Alias
-
Gene Description
citrate synthase
Omim ID
118950Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a Krebs tricarboxylic acid cycle enzyme that catalyzes the synthesis of citrate from oxaloacetate and acetyl coenzyme A. The enzyme is found in nearly all cells capable of oxidative metablism. This protein is nuclear encoded and transported into the mitochondrial matrix, where the mature form is found. [provided by RefSeq
Other Designations
citrate synthase, mitochondrial
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glyoxylate and dicarboxylate metabolism
+ View More Disease
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com