Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MKI67IP monoclonal antibody, clone CL2240

  • Catalog # : MAB15732
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human MKI67IP.
  • Immunogen:
  • Recombinant protein corresponding to human MKI67IP.
  • Sequence:
  • IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG2a
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence KVSGTLDTPE as determined by overlapping synthetic peptides.
  • Applications
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human fallopian tube with MKI67IP monoclonal antibody, clone CL2240 (Cat # MAB15732) shows strong nucleolar immunoreactivity in glandular and connective tissue cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of MCF7 cells with MKI67IP monoclonal antibody, clone CL2240 (Cat # MAB15732) (Green) shows specific nucleoli. Microtubule and nuclear probes are visualized in red and blue respectively (where available).
  • Application Image
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Gene Name:
  • MKI67IP
  • Gene Alias:
  • NIFK,Nopp34
  • Gene Description:
  • MKI67 (FHA domain) interacting nucleolar phosphoprotein
  • Gene Summary:
  • This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.[provided by RefSeq
  • Other Designations:
  • nucleolar phosphoprotein Nopp34,nucleolar protein interacting with the FHA domain of pKi-67
  • RSS
  • YouTube
  • Linkedin
  • Facebook