Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MST1R monoclonal antibody, clone CL0463

  • Catalog # : MAB15629
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human MST1R.
  • Immunogen:
  • Recombinant protein corresponding to human MST1R.
  • Sequence:
  • EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence DPQGWVAGNL as determined by overlapping synthetic peptides.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of RT-4 cell lysate with MST1R monoclonal antibody, clone CL0463 (Cat # MAB15629).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4486
  • Gene Name:
  • MST1R
  • Gene Alias:
  • CD136,CDw136,PTK8,RON
  • Gene Description:
  • macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
  • Other Designations:
  • PTK8 protein tyrosine kinase 8,c-met-related tyrosine kinase,macrophage stimulating 1 receptor,soluble RON variant 1,soluble RON variant 2,soluble RON variant 3,soluble RON variant 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook