DICER1 monoclonal antibody, clone CL0378
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of HEK293T cell lysate with DICER1 monoclonal antibody, clone CL0378 (Cat # MAB15623).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human uterus with DICER1 monoclonal antibody, clone CL0378 (Cat # MAB15623) shows cytoplasmic immunoreactivity in the glandular epithelium cells.
Immunofluorescence
Immunofluorescent staining of A-431 cells with DICER1 monoclonal antibody, clone CL0378 (Cat # MAB15623) (Green) shows specific staining in the cytosol. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human DICER1.
Immunogen
Recombinant protein corresponding to human DICER1.
Epitope
This antibody binds to an epitope located within the peptide sequence LSSAEKRKAK as determined by overlapping synthetic peptides.
Sequence
PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG2a
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of HEK293T cell lysate with DICER1 monoclonal antibody, clone CL0378 (Cat # MAB15623).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human uterus with DICER1 monoclonal antibody, clone CL0378 (Cat # MAB15623) shows cytoplasmic immunoreactivity in the glandular epithelium cells.Immunofluorescence
Immunofluorescent staining of A-431 cells with DICER1 monoclonal antibody, clone CL0378 (Cat # MAB15623) (Green) shows specific staining in the cytosol. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). -
Gene Info — DICER1
Entrez GeneID
23405Protein Accession#
Q9UPY3Gene Name
DICER1
Gene Alias
DCR1, Dicer, HERNA, KIAA0928
Gene Description
dicer 1, ribonuclease type III
Omim ID
606241Gene Ontology
HyperlinkGene Summary
This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
Dicer1, Dcr-1 homolog|K12H4.8-LIKE|dicer 1, double-stranded RNA-specific endoribonuclease|dicer1|helicase with RNAse motif|helicase-moi
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com