CTCF monoclonal antibody, clone CL0304
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human CTCF.
Immunogen
Recombinant protein corresponding to human CTCF.
Epitope
This antibody binds to an epitope located within the peptide sequence AYENEVSKEG as determined by overlapping synthetic peptides.
Sequence
QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG2a
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of U-251 MG cell lysate with CTCF monoclonal antibody, clone CL0304 (Cat # MAB15597).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human stomach with CTCF monoclonal antibody, clone CL0304 (Cat # MAB15597) shows nuclear positivity in glandular cells. -
Gene Info — CTCF
Entrez GeneID
10664Protein Accession#
P49711Gene Name
CTCF
Gene Alias
-
Gene Description
CCCTC-binding factor (zinc finger protein)
Omim ID
604167Gene Ontology
HyperlinkGene Summary
This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors. [provided by RefSeq
Other Designations
11 zinc finger transcriptional repressor|11-zinc finger protein|CCCTC-binding factor|CTCFL paralog|transcriptional repressor CTCF
-
Interactome
-
Disease
-
Publication Reference
-
Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection.
Andersson S, Konrad A, Ashok N, Pontén F, Hober S, Asplund A.
The Journal of Histochemistry and Cytochemistry 2013 Nov; 61(11):773.
Application:IHC-P, Human, Uterus.
-
Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com