TSPAN7 monoclonal antibody, clone CL0262
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with TSPAN7 monoclonal antibody, clone CL0262 (Cat # MAB15581).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with TSPAN7 monoclonal antibody, clone CL0262 (Cat # MAB15581) shows strong immunoreactivity in the neuropil.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human TSPAN7.
Immunogen
Recombinant protein corresponding to human TSPAN7.
Epitope
This antibody binds to an epitope located within the peptide sequence NDERSRAVDHVQRSL as determined by overlapping synthetic peptides.
Sequence
TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with TSPAN7 monoclonal antibody, clone CL0262 (Cat # MAB15581).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with TSPAN7 monoclonal antibody, clone CL0262 (Cat # MAB15581) shows strong immunoreactivity in the neuropil. -
Gene Info — TSPAN7
Entrez GeneID
7102Protein Accession#
P41732Gene Name
TSPAN7
Gene Alias
A15, CCG-B7, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2, TM4SF2b
Gene Description
tetraspanin 7
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. [provided by RefSeq
Other Designations
CD231 antigen|T-cell acute lymphoblastic leukemia associated antigen 1|cell surface glycoprotein A15|membrane component, X chromosome, surface marker 1|tetraspanin protein|transmembrane 4 superfamily 2b|transmembrane 4 superfamily member 2|transmembrane p
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com