Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VANGL1 monoclonal antibody, clone CL0241

  • Catalog # : MAB15577
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human VANGL1.
  • Immunogen:
  • Recombinant protein corresponding to human VANGL1.
  • Sequence:
  • DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of MCF-7 cell lysate with VANGL1 monoclonal antibody, clone CL0241 (Cat # MAB15577).
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of A-431 cells with VANGL1 monoclonal antibody, clone CL0241 (Cat # MAB15577) (Green) shows specific staining of plasma membrane. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • VANGL1
  • Gene Alias:
  • LPP2,MGC5338,STB2,STBM2
  • Gene Description:
  • vang-like 1 (van gogh, Drosophila)
  • Other Designations:
  • OTTHUMP00000013751,OTTHUMP00000013752,loop-tail protein 2,van gogh-like 1,vang (van gogh, Drosophila)-like 1, vang, van gogh-like 1,vang-like 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook