S100A4 monoclonal antibody, clone CL0237
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human S100A4.
Immunogen
Recombinant protein corresponding to human S100A4.
Epitope
This antibody binds to an epitope located within the peptide sequence KFKLNKSELKELLTR as determined by overlapping synthetic peptides.
Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-1:5000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with S100A4 monoclonal antibody, clone CL0237 (Cat # MAB15574).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human skin with S100A4 monoclonal antibody, clone CL0237 (Cat # MAB15574) shows strong immunoreactivity in Langerhans cells and in fibroblasts in the underlying connective tissue. -
Gene Info — S100A4
Entrez GeneID
6275Protein Accession#
P26447Gene Name
S100A4
Gene Alias
18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
Gene Description
S100 calcium binding protein A4
Omim ID
114210Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000015467|OTTHUMP00000015468|OTTHUMP00000015469|OTTHUMP00000032895|S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)|S100 calcium-binding protein A4|S100 calcium-binding protein A4 (calcium prote
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com