RUNX2 monoclonal antibody, clone CL0232
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of U-251 MG cell lysate with RUNX2 monoclonal antibody, clone CL0232 (Cat # MAB15571).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with RUNX2 monoclonal antibody, clone CL0232 (Cat # MAB15571) shows nuclear immunoreactivity in a subset of lymphoid cells outside the reaction centrum.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human RUNX2.
Immunogen
Recombinant protein corresponding to human RUNX2.
Epitope
This antibody binds to an epitope located within the peptide sequence VPRRISGASELGPFS as determined by overlapping synthetic peptides.
Sequence
LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG2a
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of U-251 MG cell lysate with RUNX2 monoclonal antibody, clone CL0232 (Cat # MAB15571).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with RUNX2 monoclonal antibody, clone CL0232 (Cat # MAB15571) shows nuclear immunoreactivity in a subset of lymphoid cells outside the reaction centrum. -
Gene Info — RUNX2
Entrez GeneID
860Protein Accession#
Q13950Gene Name
RUNX2
Gene Alias
AML3, CBFA1, CCD, CCD1, MGC120022, MGC120023, OSF2, PEA2aA, PEBP2A1, PEBP2A2, PEBP2aA, PEBP2aA1
Gene Description
runt-related transcription factor 2
Gene Ontology
HyperlinkGene Summary
This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. [provided by RefSeq
Other Designations
CBF-alpha 1|OTTHUMP00000016533|SL3-3 enhancer factor 1 alpha A subunit|SL3/AKV core-binding factor alpha A subunit|acute myeloid leukemia 3 protein|core-binding factor, runt domain, alpha subunit 1|osteoblast-specific transcription factor 2|polyomavirus e
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com