Product Browser

Last updated: 2017/7/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APOL1 monoclonal antibody, clone CL0173

  • Catalog # : MAB15550
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human APOL1.
  • Immunogen:
  • Recombinant protein corresponding to human APOL1.
  • Sequence:
  • SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Epitope:
  • This antibody binds to an epitope located within the peptide sequence GIGKDIRALR as determined by overlapping synthetic peptides.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • Western Blot analysis of human plasma tissue lysate with APOL1 monoclonal antibody, clone CL0173 (Cat # MAB15550).
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 8542
  • Gene Name:
  • APOL1
  • Gene Alias:
  • APO-L,APOL,APOL-I
  • Gene Description:
  • apolipoprotein L, 1
  • Gene Summary:
  • This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028705,apolipoprotein L-I,apolipoprotein L1
  • RSS
  • YouTube
  • Linkedin
  • Facebook