Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZEB1 monoclonal antibody, clone CL0151

  • Catalog # : MAB15542
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human ZEB1.
  • Immunogen:
  • Recombinant protein corresponding to human ZEB1.
  • Sequence:
  • EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Immunofluorescence (1-4 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
    Western Blot (1:500-1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of Lane 1: RH-30 and Lane 2: CACO-2 cell lysates with ZEB1 monoclonal antibody, clone CL0151 (Cat # MAB15542).
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with ZEB1 monoclonal antibody, clone CL0151 (Cat # MAB15542) shows moderate to strong nuclear immunoreactivity in neuronal and glial cells.
  • Immunofluorescence
  • Immunofluorescence
  • Immunofluorescent staining of A-549 cells with ZEB1 monoclonal antibody, clone CL0151 (Cat # MAB15542) (Green) shows nuclear (without nucleoli). Microtubule probes are visualized in red (where available).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 6935
  • Gene Name:
  • ZEB1
  • Gene Alias:
  • AREB6,BZP,DELTA-EF1,MGC133261,NIL-2-A,NIL-2A,NIL2A,TCF8,ZEB,ZFHEP,ZFHX1A
  • Gene Description:
  • zinc finger E-box binding homeobox 1
  • Gene Summary:
  • ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000019405,transcription factor 8 (represses interleukin 2 expression),zinc finger homeodomain enhancer-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook