SOX11 monoclonal antibody, clone CL0143
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with SOX11 monoclonal antibody, clone CL0143 (Cat # MAB15541).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human mantle cell lymphoma with SOX11 monoclonal antibody, clone CL0143 (Cat # MAB15541) shows strong nuclear positivity in a majority of tumor cells.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human SOX11.
Immunogen
Recombinant protein corresponding to human SOX11.
Epitope
This antibody binds to an epitope located within the peptide sequence IPFIREAERL as determined by overlapping synthetic peptides.
Sequence
FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG2a
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with SOX11 monoclonal antibody, clone CL0143 (Cat # MAB15541).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human mantle cell lymphoma with SOX11 monoclonal antibody, clone CL0143 (Cat # MAB15541) shows strong nuclear positivity in a majority of tumor cells. -
Gene Info — SOX11
Entrez GeneID
6664Protein Accession#
P35716Gene Name
SOX11
Gene Alias
-
Gene Description
SRY (sex determining region Y)-box 11
Omim ID
600898Gene Ontology
HyperlinkGene Summary
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis. [provided by RefSeq
Other Designations
OTTHUMP00000115385|SRY (sex-determining region Y)-box 11|SRY-box 11|SRY-related HMG-box gene 11|transcription factor SOX-11
-
Interactome
-
Publication Reference
-
Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype.
Ribera-Cortada I, Martinez D, Amador V, Royo C, Navarro A, Beà S, Gine E, de Leval L, Serrano S, Wotherspoon A, Colomer D, Martinez A, Campo E.
Modern Pathology 2015 Nov; 28(11):1435.
Application：IHC-P, Human, Human mantle cell lymphomas.
-
Assessment of SOX11 expression in routine lymphoma tissue sections: characterization of new monoclonal antibodies for diagnosis of mantle cell lymphoma.
Soldini D, Valera A, Solé C, Palomero J, Amador V, Martin-Subero JI, Ribera-Cortada I, Royo C, Salaverria I, Beà S, Gonzalvo E, Johannesson H, Herrera M, Colomo L, Martinez A, Campo E.
The American Journal of Surgical Pathology 2014 Jan; 38(1):86.
Application：IHC, WB-Tr, Human, HEK 293 cells, Human lymphoid tumors.
-
Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com