OCLN monoclonal antibody, clone CL1608
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: CACO-2 and Lane 2: U-87 cell lysates with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous positivity in renal tubules.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate cancer with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous positivity in tumor cells.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows strong membranous immunoreactivity in glandular cells.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast cancer with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous immunoreactivity in tumor cells.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous immunoreactivity in hepatocytes.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous immunoreactivity in squamous epithelium cells.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human OCLN.
Immunogen
Recombinant protein corresponding to amino acids 282-415 of human OCLN.
Sequence
DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: CACO-2 and Lane 2: U-87 cell lysates with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous positivity in renal tubules.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate cancer with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous positivity in tumor cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows strong membranous immunoreactivity in glandular cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast cancer with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous immunoreactivity in tumor cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous immunoreactivity in hepatocytes.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with OCLN monoclonal antibody, clone CL1608 (Cat # MAB15536) shows membranous immunoreactivity in squamous epithelium cells. -
Gene Info — OCLN
Entrez GeneID
100506658Protein Accession#
Q16625Gene Name
OCLN
Gene Alias
BLCPMG, PPP1R115, PTORCH1
Gene Description
occludin
Gene Ontology
HyperlinkGene Summary
regulatory subunit 115|tight junction protein occludin
Other Designations
occludin|phosphatase 1, regulatory subunit 115|tight junction protein occludin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com