Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MKL2 monoclonal antibody, clone CL1546

  • Catalog # : MAB15533
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human MKL2.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 136-273 of human MKL2.
  • Sequence:
  • QRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDSSDALSPDQPASQESQGSAASPSEPKVSESPSPVTTNTPAQFASVSPTVPEFLKTPPTADQPPPRPAAPVLPTNTVSSAKPGPALVKQSHPKNP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A purification
  • Isotype:
  • IgG1
  • Recommend Usage:
  • Western Blot (1:500 - 1:1000)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
  • Storage Instruction:
  • Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • Western Blot analysis of RT-4 cell lysates with MKL2 monoclonal antibody, clone CL1546 (Cat # MAB15533).
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MKL2
  • Gene Alias:
  • DKFZp686J1745,FLJ31823,FLJ45623,MRTF-B,NPD001
  • Gene Description:
  • MKL/myocardin-like 2
  • Other Designations:
  • megakaryoblastic leukemia 2,megakaryoblastic leukemia 2 protein,myocardin-related transcription factor B
  • RSS
  • YouTube
  • Linkedin
  • Facebook