CD3E monoclonal antibody, clone CL1497
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human CD3E.
Immunogen
Recombinant protein corresponding to amino acids 25-126 of human CD3E.
Sequence
NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000 - 1:2500)
Western Blot (1:500 - 1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human tonsil tissue lysate with CD3E monoclonal antibody, clone CL1497 (Cat # MAB15531).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human rectum with CD3E monoclonal antibody, clone CL1497 (Cat # MAB15531) shows strong immunoreactivity in a subset of lymphoid cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human fallopian tube with CD3E monoclonal antibody, clone CL1497 (Cat # MAB15531) shows strong positivity in a subset of lymphoid cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human colon with CD3E monoclonal antibody, clone CL1497 (Cat # MAB15531) shows strong immunoreactivity in lymphoid cells.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human tonsil with CD3E monoclonal antibody, clone CL1497 (Cat # MAB15531) shows strong positivity in a subset of lymphoid cells. -
Gene Info — CD3E
Entrez GeneID
916Protein Accession#
P07766Gene Name
CD3E
Gene Alias
FLJ18683, T3E, TCRE
Gene Description
CD3e molecule, epsilon (CD3-TCR complex)
Omim ID
186830Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq
Other Designations
CD3-epsilon|CD3E antigen, epsilon polypeptide|CD3e antigen, epsilon polypeptide (TiT3 complex)|T-cell antigen receptor complex, epsilon subunit of T3|T-cell surface antigen T3/Leu-4 epsilon chain|T-cell surface glycoprotein CD3 epsilon chain
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com