Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAP3K1 monoclonal antibody, clone 2F6

  • Catalog # : MAB13348
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against partial recombinant human MAP3K1.
  • Immunogen:
  • Recombinant protein corresponding to amino acids 1077-1176 of human MAP3K1.
  • Sequence:
  • SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK
  • Host:
  • Mouse
  • Theoretical MW (kDa):
  • 195, 80
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Purification:
  • Protein A/G purification
  • Isotype:
  • IgG2a, kappa
  • Recommend Usage:
  • Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL)
    Immunofluorescence (1-2 ug/mL)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.5-1 ug/mL)
    Western Blot (0.5-1 ug/mL)
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 10 mM PBS.
  • Storage Instruction:
  • Store at -20 to -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human uterine carcinoma (A), human thyroid carcinoma (B) and human cervical carcinoma (C) with MAP3K1 monoclonal antibody, clone 2F6 (Cat # MAB13348).
  • Immunofluorescence
  • Flow Cytometry
  • Application Image
  • Western Blot
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Immunofluorescence
  • Flow Cytometry
  • Gene Information
  • Entrez GeneID:
  • 4214
  • Gene Name:
  • MAP3K1
  • Gene Alias:
  • MAPKKK1,MEKK,MEKK1
  • Gene Description:
  • mitogen-activated protein kinase kinase kinase 1
  • Gene Summary:
  • MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM
  • Other Designations:
  • MAP/ERK kinase kinase 1,MAPK/ERK kinase kinase 1,MEK kinase 1,OTTHUMP00000065818
  • RSS
  • YouTube
  • Linkedin
  • Facebook