Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF10C monoclonal antibody (M01), clone 3A1

  • Catalog # : MAB1300-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TNFRSF10C.
  • Immunogen:
  • TNFRSF10C (NP_003832.2, 25 a.a. ~ 161 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVET
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of MAB1300-M01
    Western Blot detection against Immunogen (41.14 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8794
  • Gene Name:
  • TNFRSF10C
  • Gene Alias:
  • CD263,DCR1,LIT,MGC149501,MGC149502,TRAILR3,TRID
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. [provided by RefSeq
  • Other Designations:
  • TNF related TRAIL receptor,TNF related apoptosis-inducing ligand receptor 3,TRAIL receptor 3,antagonist decoy receptor for TRAIL/Apo-2L,decoy receptor 1,decoy without an intracellular domain,lymphocyte inhibitor of TRAIL,tumor necrosis factor receptor sup
  • RSS
  • YouTube
  • Linkedin
  • Facebook