Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC2L2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00728642-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDC2L2 partial ORF ( NP_277073, 681 a.a. - 780 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00728642-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CDC2L2
  • Gene Alias:
  • CDC2L3,CDK11-p110,CDK11-p46,CDK11-p58,MGC131975,PITSLRE,p58GTA
  • Gene Description:
  • cell division cycle 2-like 2 (PITSLRE proteins)
  • Gene Summary:
  • This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L1, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L1, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions, which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L1 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Many transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only two have been determined so far. [provided by RefSeq
  • Other Designations:
  • PITSLRE B,PITSLRE protein kinase beta,PITSLRE serine/threonine-protein kinase CDC2L2,cell division cycle 2-like 2,cell division cycle 2-like protein kinase 2,galactosyltransferase-associated protein kinase p58/GTA
  • RSS
  • YouTube
  • Linkedin
  • Facebook