CDC2L2 monoclonal antibody (M01), clone 1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDC2L2.
Immunogen
CDC2L2 (NP_277073, 681 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDC2L2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CDC2L2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CDC2L2
Entrez GeneID
728642GeneBank Accession#
NM_033531Protein Accession#
NP_277073Gene Name
CDC2L2
Gene Alias
CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, MGC131975, PITSLRE, p58GTA
Gene Description
cell division cycle 2-like 2 (PITSLRE proteins)
Omim ID
116951Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L1, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L1, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions, which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L1 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Many transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only two have been determined so far. [provided by RefSeq
Other Designations
PITSLRE B|PITSLRE protein kinase beta|PITSLRE serine/threonine-protein kinase CDC2L2|cell division cycle 2-like 2|cell division cycle 2-like protein kinase 2|galactosyltransferase-associated protein kinase p58/GTA
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com