Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDC2L2 monoclonal antibody (M01), clone 1A9

  • Catalog # : H00728642-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CDC2L2.
  • Immunogen:
  • CDC2L2 (NP_277073, 681 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged CDC2L2 is approximately 0.03ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • CDC2L2
  • Gene Alias:
  • CDC2L3,CDK11-p110,CDK11-p46,CDK11-p58,MGC131975,PITSLRE,p58GTA
  • Gene Description:
  • cell division cycle 2-like 2 (PITSLRE proteins)
  • Gene Summary:
  • This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L1, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L1, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions, which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L1 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Many transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only two have been determined so far. [provided by RefSeq
  • Other Designations:
  • PITSLRE B,PITSLRE protein kinase beta,PITSLRE serine/threonine-protein kinase CDC2L2,cell division cycle 2-like 2,cell division cycle 2-like protein kinase 2,galactosyltransferase-associated protein kinase p58/GTA
  • RSS
  • YouTube
  • Linkedin
  • Facebook