SSX4B purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SSX4B protein.
Immunogen
SSX4B (AAI53139.1, 1 a.a. ~ 188 a.a) full-length human protein.
Sequence
MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (54)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SSX4B expression in transfected 293T cell line (H00548313-T01) by SSX4B MaxPab polyclonal antibody.
Lane 1: SSX4B transfected lysate(20.68 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SSX4B
Entrez GeneID
548313GeneBank Accession#
BC153138.1Protein Accession#
AAI53139.1Gene Name
SSX4B
Gene Alias
MGC169015, MGC169016
Gene Description
synovial sarcoma, X breakpoint 4B
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4B, represents the more centromeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000023258|OTTHUMT00000056510
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com