Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GIMAP6 mouse monoclonal antibody (hybridoma)

  • Catalog # : H00474344-M
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant GIMAP6.
  • Immunogen:
  • GIMAP6 (NP_078987.3, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactivity and specificity confirmed by ELISA and Western Blot.
  • Note:
  • Customer should check the viability of the hybridomas within one month from the date of receipt. Fee-for-service of long term hybridoma storage can be performed upon customer's request.
  • Deliverables:
  • Up to 5 positive hybridoma clones will be delivered to customer in the cryotube format.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • GIMAP6
  • Gene Alias:
  • DKFZp686A01175,FLJ22690,IAN6,hIAN2
  • Gene Description:
  • GTPase, IMAP family member 6
  • Gene Summary:
  • This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • human immune associated nucleotide 2,immune associated nucleotide 2,immune associated nucleotide 6
  • RSS
  • YouTube
  • Linkedin
  • Facebook