GIMAP6 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GIMAP6 expression in transfected 293T cell line (H00474344-T01) by GIMAP6 MaxPab polyclonal antibody.
Lane 1: GIMAP6 transfected lysate(32.12 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GIMAP6 protein.
Immunogen
GIMAP6 (NP_078987.3, 1 a.a. ~ 292 a.a) full-length human protein.
Sequence
MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (63); Rat (64)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GIMAP6 expression in transfected 293T cell line (H00474344-T01) by GIMAP6 MaxPab polyclonal antibody.
Lane 1: GIMAP6 transfected lysate(32.12 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GIMAP6
Entrez GeneID
474344GeneBank Accession#
NM_024711.3Protein Accession#
NP_078987.3Gene Name
GIMAP6
Gene Alias
DKFZp686A01175, FLJ22690, IAN6, hIAN2
Gene Description
GTPase, IMAP family member 6
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene. [provided by RefSeq
Other Designations
human immune associated nucleotide 2|immune associated nucleotide 2|immune associated nucleotide 6
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com