Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRIM6-TRIM34 polyclonal antibody (A01)

  • Catalog # : H00445372-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TRIM6-TRIM34.
  • Immunogen:
  • TRIM6-TRIM34 (NP_001003819, 641 a.a. ~ 740 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LQMFRELTAVRCYWVDVTLNSVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTAWILGVYCRTYSRHMKYVVRRCANRQN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00445372-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TRIM6-TRIM34 polyclonal antibody (A01), Lot # 051115JCO1 Western Blot analysis of TRIM6-TRIM34 expression in Hela S3 NE ( Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TRIM6-TRIM34 polyclonal antibody (A01), Lot # 060728QCS1. Western Blot analysis of TRIM6-TRIM34 expression in Jurkat.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TRIM6-TRIM34
  • Gene Alias:
  • IFP1,RNF21,TRIM34
  • Gene Description:
  • TRIM6-TRIM34 readthrough transcript
  • Gene Summary:
  • The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene represents a read-through transcript transcribed from genes TRIM6 and TRIM34, and it was described as a splice variant of TRIM34. This gene is mapped to chromosome 11p15, where it resides within a TRIM gene cluster. [provided by RefSeq
  • Other Designations:
  • interferon-responsive finger protein 1,tripartite motif-containing 6 and tripartite motif-containing 34
  • RSS
  • YouTube
  • Linkedin
  • Facebook