Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SULT1A4 (Human) Recombinant Protein (P01)

  • Catalog # : H00445329-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SULT1A4 full-length ORF ( ADR82917.1, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SULT1A4
  • Gene Alias:
  • -
  • Gene Description:
  • sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4
  • Gene Summary:
  • Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16, this gene and SULT1A3 arose from a segmental duplication. Exons of this gene overlap with exons of a gene that encodes a protein containing GIY-YIG domains (GIYD2). Multiple alternatively spliced variants that encode the same protein have been described. [provided by RefSeq
  • Other Designations:
  • aryl sulfotransferase,phenol sulfotransferase,sulfokinase
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook