Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BPY2C (Human) Recombinant Protein (P01)

  • Catalog # : H00442868-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BPY2C full-length ORF ( AAI56665.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.06
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • BPY2C
  • Gene Alias:
  • BPY2,VCY2,VCY2C
  • Gene Description:
  • basic charge, Y-linked, 2C
  • Gene Summary:
  • This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. The encoded protein interacts with ubiquitin protein ligase E3A and may be involved in male germ cell development and male infertility. Three nearly identical copies of this gene exist on chromosome Y; two copies are part of a palindromic region. This record represents the more telomeric copy within the palindrome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000042658,basic protein on Y chromosome 2,testis-specific basic protein on Y, 2,variable charge, Y-linked, 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook