NOMO3 monoclonal antibody (M03), clone 5A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NOMO3 monoclonal antibody (M03), clone 5A7. Western Blot analysis of NOMO3 expression in Jurkat.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NOMO3 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.22 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NOMO3.
Immunogen
NOMO3 (NP_001004067.1, 966 a.a. ~ 1033 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.22 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NOMO3 monoclonal antibody (M03), clone 5A7. Western Blot analysis of NOMO3 expression in Jurkat.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NOMO3 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — NOMO3
Entrez GeneID
408050GeneBank Accession#
NM_001004067Protein Accession#
NP_001004067.1Gene Name
NOMO3
Gene Alias
Nomo
Gene Description
NODAL modulator 3
Omim ID
609159Gene Ontology
HyperlinkGene Summary
This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a duplicated region on the short arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum. [provided by RefSeq
Other Designations
nodal modulator 3|pM5 protein, middle copy
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com