SPINK6 monoclonal antibody (M04), clone 3C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPINK6 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant SPINK6.
Immunogen
SPINK6 (AAH32003.1, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SPINK6 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SPINK6
Entrez GeneID
404203GeneBank Accession#
BC032003.1Protein Accession#
AAH32003.1Gene Name
SPINK6
Gene Alias
BUSI2, MGC21394, UNQ844
Gene Description
serine peptidase inhibitor, Kazal type 6
Gene Ontology
HyperlinkGene Summary
O
Other Designations
acrosin inhibitor|protease inhibitor H|serine protease inhibitor, Kazal type 6
-
Publication Reference
-
SPINK6 inhibits human airway serine proteases and restricts influenza virus activation.
Dong Wang, Cun Li, Man Chun Chiu, Yifei Yu, Xiaojuan Liu, Xiaoyu Zhao, Jingjing Huang, Zhongshan Cheng, Shuofeng Yuan, Vincent Poon, Jian-Piao Cai, Hin Chu, Jasper Fuk-Woo Chan, Kelvin Kai-Wang To, Kwok Yung Yuen, Jie Zhou.
EMBO Molecular Medicine 2022 Jan; 14(1):e14485.
Application：WB-Tr, Flow Cyt, Human, HEK 293T (Bosc 23) cells, airway organoids (human lung).
-
SPINK6 inhibits human airway serine proteases and restricts influenza virus activation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com