HAPLN4 monoclonal antibody (M12), clone 1G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HAPLN4 monoclonal antibody (M12), clone 1G5. Western Blot analysis of HAPLN4 expression in Raw 264.7 ( Cat # L024V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HAPLN4 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.29 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HAPLN4.
Immunogen
HAPLN4 (NP_075378, 30 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (97)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HAPLN4 monoclonal antibody (M12), clone 1G5. Western Blot analysis of HAPLN4 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HAPLN4 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — HAPLN4
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com