Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CENPP monoclonal antibody (M07), clone 3G8

  • Catalog # : H00401541-M07
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CENPP.
  • Immunogen:
  • CENPP (NP_001012267, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00401541-M07
    Western Blot detection against Immunogen (36.52 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CENPP monoclonal antibody (M07), clone 3G8. Western Blot analysis of CENPP expression in K-562.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CENPP expression in transfected 293T cell line by CENPP monoclonal antibody (M07), clone 3G8.

    Lane 1: CENPP transfected lysate(33.165 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CENPP
  • Gene Alias:
  • CENP-P,FLJ33928
  • Gene Description:
  • centromere protein P
  • Gene Summary:
  • CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000021661
  • RSS
  • YouTube
  • Linkedin
  • Facebook