VHLL (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human VHLL full-length ORF ( ADR83480.1, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVWLNYYGKLLPYLTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
15.3
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — VHLL
Entrez GeneID
391104GeneBank Accession#
HQ258729.1Protein Accession#
ADR83480.1Gene Name
VHLL
Gene Alias
VLP
Gene Description
von Hippel-Lindau tumor suppressor-like
Gene Ontology
HyperlinkGene Summary
Von Hippel-Lindau (VHL) tumor suppressor protein is a component of an E3 ubiquitin ligase complex that the selectively ubiquitinates the alpha subunit of the hypoxia-inducible factor (HIF) transcription factor for proteasome-mediated degradation. Inactivation of VHL causes VHL disease and sporadic kidney cancer. This gene encodes a VHL homolog that lacks one of two key domains necessary for VHL function. It binds HIF alpha but fails to recruit the E3 ubiquitin ligase complex, and therefore functions as a dominant-negative VHL and a protector of HIF alpha. This gene is intronless and predominantly expressed in the placenta, and may contribute to the regulation of oxygen homeostasis and neovascularization during placenta development. [provided by RefSeq
Other Designations
von-Hippel-Lindau-like protein
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com