Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

VHLL purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00391104-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human VHLL protein.
  • Immunogen:
  • VHLL (ADR83480.1, 1 a.a. ~ 139 a.a) full-length human protein.
  • Sequence:
  • MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVWLNYYGKLLPYLTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of VHLL expression in transfected 293T cell line (H00391104-T01) by VHLL MaxPab polyclonal antibody.

    Lane 1: VHLL transfected lysate(15.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • VHLL
  • Gene Alias:
  • VLP
  • Gene Description:
  • von Hippel-Lindau tumor suppressor-like
  • Gene Summary:
  • Von Hippel-Lindau (VHL) tumor suppressor protein is a component of an E3 ubiquitin ligase complex that the selectively ubiquitinates the alpha subunit of the hypoxia-inducible factor (HIF) transcription factor for proteasome-mediated degradation. Inactivation of VHL causes VHL disease and sporadic kidney cancer. This gene encodes a VHL homolog that lacks one of two key domains necessary for VHL function. It binds HIF alpha but fails to recruit the E3 ubiquitin ligase complex, and therefore functions as a dominant-negative VHL and a protector of HIF alpha. This gene is intronless and predominantly expressed in the placenta, and may contribute to the regulation of oxygen homeostasis and neovascularization during placenta development. [provided by RefSeq
  • Other Designations:
  • von-Hippel-Lindau-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook