VHLL purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human VHLL protein.
Immunogen
VHLL (ADR83480.1, 1 a.a. ~ 139 a.a) full-length human protein.
Sequence
MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVWLNYYGKLLPYLTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of VHLL expression in transfected 293T cell line (H00391104-T01) by VHLL MaxPab polyclonal antibody.
Lane 1: VHLL transfected lysate(15.3 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — VHLL
Entrez GeneID
391104GeneBank Accession#
HQ258729.1Protein Accession#
ADR83480.1Gene Name
VHLL
Gene Alias
VLP
Gene Description
von Hippel-Lindau tumor suppressor-like
Gene Ontology
HyperlinkGene Summary
Von Hippel-Lindau (VHL) tumor suppressor protein is a component of an E3 ubiquitin ligase complex that the selectively ubiquitinates the alpha subunit of the hypoxia-inducible factor (HIF) transcription factor for proteasome-mediated degradation. Inactivation of VHL causes VHL disease and sporadic kidney cancer. This gene encodes a VHL homolog that lacks one of two key domains necessary for VHL function. It binds HIF alpha but fails to recruit the E3 ubiquitin ligase complex, and therefore functions as a dominant-negative VHL and a protector of HIF alpha. This gene is intronless and predominantly expressed in the placenta, and may contribute to the regulation of oxygen homeostasis and neovascularization during placenta development. [provided by RefSeq
Other Designations
von-Hippel-Lindau-like protein
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com