Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HES5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00388585-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HES5 partial ORF (NP_001010926.1, 28 a.a. - 121 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
  • Theoretical MW (kDa):
  • 35.97
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00388585-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • HES5
  • Gene Alias:
  • bHLHb38
  • Gene Description:
  • hairy and enhancer of split 5 (Drosophila)
  • Gene Summary:
  • This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000000867,hairy and enhancer of split 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook