Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HES5 monoclonal antibody (M05), clone 3B6

  • Catalog # : H00388585-M05
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant HES5.
  • Immunogen:
  • HES5 (NP_001010926, 28 a.a. ~ 121 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00388585-M05
    Western Blot detection against Immunogen (36.34 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • HES5
  • Gene Alias:
  • bHLHb38
  • Gene Description:
  • hairy and enhancer of split 5 (Drosophila)
  • Gene Summary:
  • This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000000867,hairy and enhancer of split 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook