Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SETD8 (Human) Recombinant Protein (P01)

  • Catalog # : H00387893-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SETD8 full-length ORF (NP_065115.3, 1 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 65.12
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SETD8
  • Gene Alias:
  • KMT5A,PR-Set7,SET07,SET8
  • Gene Description:
  • SET domain containing (lysine methyltransferase) 8
  • Other Designations:
  • H4-K20-specific histone methyltransferase,PR/SET domain containing protein 8,SET domain-containing protein 8
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook